ISS1S

  • Family IS6
  • Group
MGE type ISRelated element(s) :
Isoform Synonym(s) SK7
Accession numberTranspositionOriginHost
M18294 Y Lactococcus lactis
Lactococcus lactis subsp. lactis ML3 plasmid pSK08
DNA section
IS Length : 808 bp

Ends


IR Length : 18

IRL : GGTTCTGTTGCAAAGTTTTCGGATAAGTCTATTTTAGTGTAAAATGAATA
IRR : GGTTCTGTTGCAAAGTTTAAAAATCAAATACAAGGTTTATAATCCTTCTT

Insertion site


Left flankDirect repeatRight flankDR Length
NNNNCATTCAATGAAATCATTCTANNNN8

DNA sequence

GGTTCTGTTGCAAAGTTTTCGGATAAGTCTATTTTAGTGTAAAATGAATAAAAATGACAGCGAGGATATATCAATGAACTATTTTAAAGGTAAACAATTT
CAAAAAGATGTGATTATTGTCGCTGTTGGTTATTATCTACGTTACAATCTAAGCTATCGTGAAATTCAAGAACTCCTTTATGATCGTGGGATTAACGTTT
GTCACACAACTATTTATCGTTGGGTACAAGAATACAGTAAAGTCCTCTATCATCTCTGGAAAAAGAAAAATAGACAGTCCTTCTATTCGTGGAAAATGGA
TGAAACTTATATCAAAATCAAAGGTCGTTGGCATTATCTCTATCGTGCAATTGATGCGGATGGATTGACTTTAGACATCTGGCTACGCAAGAAACGGAAT
ACGCAAGCTGCTTATGCGTTCTTGAAACGACTACATAAACAGTTTGGTCAACCAAGAGTAATTGTCACGGATAAAGCGCCCTCTATTGGTTCTGCATTTA
GAAAGTTACAGAGTAACGGTTTATATACTAAGACAGAGCATCGAACCGTGAAGTATCTCAATAACCTCATTGAGCAAGACCATCGACCAATCAAACGACG
CAATAAATTTTATCGAAGTCTACGAACTGCCTCAACCACGATTAAGGGCATGGAAACAATTCGAGGAATATACAAAAAGAACCGAAGAAATGGAACGCTC
TTCGGATTTTCGGTATCTACTGAGATTAAGGTCTTAATGGGAATATTAGCTTAAGAACAAGAAGGATTATAAACCTTGTATTTGATTTTTAAACTTTGCA
ACAGAACC
Protein section
ORF number : 1

 

ORF 1
LengthBeginEndStrandFusion ORF
681 bp226 aa74754+No
ORF function : Transposase
Chemistry : DDE

ORF sequence :

MNYFKGKQFQKDVIIVAVGYYLRYNLSYREIQELLYDRGINVCHTTIYRWVQEYSKVLYHLWKKKNRQSFYSWKMDETYIKIKGRWHYLYRAIDADGLTL
DIWLRKKRNTQAAYAFLKRLHKQFGQPRVIVTDKAPSIGSAFRKLQSNGLYTKTEHRTVKYLNNLIEQDHRPIKRRNKFYRSLRTASTTIKGMETIRGIY
KKNRRNGTLFGFSVSTEIKVLMGILA

 

Blast result :
Comments
ISS1S differs from ISS1T and IS946 by 4 and 27 bp, respectively. ISS1S (ISS1T) transposase shares 45 % identity with that of IS26. ISS1S and the pG+host gram+ plasmid have been derived into a thermosensitive transposition vector suitable for random insertion in Enterococcus faecalis, Streptococcus thermophilus and several lactococci (Maguin et al., 1996).
One complete and one truncated copie of an ISS1S-like element were present in Lactococcus lactis pNZ4000 respectively at coordinates 5447-5924 and 5905-6714. This element was 99% aa homologous with IS946V, 98%aa homologous with ISS1Rs and ISS1S.
References
1] Polzin, K.M., and Shimizu-Kadota (1987) J. Bacteriol. 169, 5481-5488.
2] Maguin, E., Prévost, H., Ehrlich, D., and Gruss, A. (1996) J. Bacteriol. 178, 931-935.