ISHla10

  • Family ISH6
  • Group
MGE type ISRelated element(s) :
Isoform Synonym(s)
Accession numberTranspositionOriginHost
NC_012029 ND Halorubrum lacusprofundi
Halorubrum lacusprofundi ATCC 49239 plasmid pHLAC01
Halorubrum lacusprofundi ATCC 49239
Halophilic archaeon DL31
Halophilic archaeon DL31 plasmid phalar01
DNA section
IS Length : 1444 bp

Ends


IR Length : 22/27

IRL : GGTCGTGTCGCAAAGTCCTCTAGAGTTCAGTAGTAACTGACTCCCGTGAA
IRR : GGTCGTGTTGCAAAGCGGTCTAGACTTTGCCGCTGGTACTCTCAATTGAG

Insertion site


Left flankDirect repeatRight flankDR Length
CGCCGGTTCCAAGTTCTTGAGGGGACCG8
TTGAGTCACCATAATAAATTGTCTCTTCTGGT8
TCGGGGTATCCTGATATTTTAACAATTTGGCCCCGAACGG0
GCCAGCTGGTGCAAGAAATAGATTTCTTTCCCGTATTTGT0
ACCGTTGACTGTGATTTCTTAACAATTGGAGGCCGATGTA0
CGAACTCAGGAATATGTTGTCGATCTGT8
AACCTAGAAATAAAGTTCTTTGTCGTTCAGTCGTAGACAA0
ACAGAGATATTTAAAAAATTAATTATTTGATCGTGGGCCA0
GACACTGACATCAAAACGTTGACTGCGCAAGT8
ATCGGCGTTGAAGAAGATCTGGACGCAGTCTC8
ACTCGGCTTGCCAATGATTGAATATTTTGACTCTATATCT0

DNA sequence

GGTCGTGTCGCAAAGTCCTCTAGAGTTCAGTAGTAACTGACTCCCGTGAAGGCGGGGTTGCCTCTGGTGTCCAAACCGAGGTACCCCATGCACGCCACAA
TCGACGTGCGGTTCGAACTGAGTATCGACGACGACAAAACGCTACCGCTCGCCACGCTTGCCGAGGCCGTCACTGACCAGAACCTCGAAGCAGTCCTTCT
CGAATCGCTGGTCGAGAGCCTCGACGCCGCCAGCGTCGAGGCGCTCTGTGGTGAGAAACACGCACATGGCAACGGTGACCAGCGCTTCCAACGCGCCGGC
ACCGACACCCGCACAGCTGTCACAACTGCCGGAGAACACGAGTTCTCTCTCCACTACGTCGAAGATACAGCCGCTTCCCCAGACGAATCCAGCTACTTCC
GGCCCGTCGAAGACGTTCTCGACTTCGACGGGCAGAACCGCTATCAGCAGGACATCGCCGCCAAAAGCGTCGATCTCGCTACCTCGCTCAGCTATCGAGA
CGCTGCCAATCACGGCGACAGCTTCGTCTCGATGCCGTCGCCGACCACCATCAACCGCCATGCCAAGAAATACGGCCACAAGCTCAAACAGTTCCTTCCA
GACTGTGTCGCTGGCACAGACGCTGACGCCGTCATTCCTGACGGGACAAAGTGCCACAGCCAAGACGACGACCGCTCGTCCCACTCCGTCCAAGCAACGC
TCGGCGAAGACACCGCCGAAGAGTCACGCTCCCTGCTGGATCTGTCGGTCAACGCTGACTGGGACGAAACTGCCGCCGAACTCGATGATATCGGCGCAGT
CACTGACGACGCGACGGTCGTCAGTGACGCTGATAGCGGCATCGTCACAGCCTTTACCGACGAAAACCGTGACCACCAGCTCGATCTCGTCCACGTCGGC
CGAACGCTGGGTTACACCCTCTGGGACGATGGCGTCTTCTCCTTGGACCGTCGGAAGGAGATCGTTTCGGAGGTGATCGACGAGGTGTTCCATCTGAAGA
ACTCTGTGGCGAAGCATCGTCCAGCGGAGGAGTTCGCGGCGATCCGCTCGCGGATCGCGCGAACGAGAGAGCGATTAGAGAAGACAGCGTGGCAACTGGA
GCAGTTCGGGTCAGCAAAGGCTGCAGGGTATCTTCGGCGGTGGCTGCCGTCGATTGTGACGTTCGCCGAGCACGCTGTCGAGGGGTTCGAGGTTCCGTGG
ACCTCGAACCCCGTCGAACGACTGATGGGCGAGGTCAGCAAGCGGTGCAAGAACCAGTGGATGCGCTGGACAGCAGAGGGATTGGAAGCGATACTCCAAC
TTCGGTTGGTGAAGTACGCCGACCCCGAGTACTACCAAGCGTTCCTCGACGAACTGCTCCAACGTTCGACCAAAACAGCAATCAACTGTGACCTCTCAAT
TGAGAGTACCAGCGGCAAAGTCTAGACCGCTTTGCAACACGACC
Protein section
ORF number : 1

 

ORF 1
LengthBeginEndStrandFusion ORF
1338 bp445 aa881425+No
ORF function : Transposase
Chemistry : DDE

ORF sequence :

MHATIDVRFELSIDDDKTLPLATLAEAVTDQNLEAVLLESLVESLDAASVEALCGEKHAHGNGDQRFQRAGTDTRTAVTTAGEHEFSLHYVEDTAASPDE
SSYFRPVEDVLDFDGQNRYQQDIAAKSVDLATSLSYRDAANHGDSFVSMPSPTTINRHAKKYGHKLKQFLPDCVAGTDADAVIPDGTKCHSQDDDRSSHS
VQATLGEDTAEESRSLLDLSVNADWDETAAELDDIGAVTDDATVVSDADSGIVTAFTDENRDHQLDLVHVGRTLGYTLWDDGVFSLDRRKEIVSEVIDEV
FHLKNSVAKHRPAEEFAAIRSRIARTRERLEKTAWQLEQFGSAKAAGYLRRWLPSIVTFAEHAVEGFEVPWTSNPVERLMGEVSKRCKNQWMRWTAEGLE
AILQLRLVKYADPEYYQAFLDELLQRSTKTAINCDLSIESTSGKV

 

Blast result :
Comments
ISHla10 is 93% aa similar to ISH6.
References
1] Guérillot R, Glaser P, (2013) Diversity of bacterial prokaryotic mutator like transposase, association with conjugation conjugative elements and insertion specificity (on preparation).
2] Lucas,S., Copeland,A., Lapidus,A., Glavina del Rio,T., Dalin,E., Tice,H., Bruce,D., Goodwin,L., Pitluck,S., Sims,D., Brettin,T., Detter,J.C., Han,C., Larimer,F., Land,M., Hauser,L., Kyrpides,N., Ivanova,N., Anderson,I., DasSarma,S., Cavicchioli,R. and Richardson,P. ( 2009) Direct submission GenBank.