ISPpa1

  • Family IS256
  • Group
MGE type ISRelated element(s) :
Isoform Synonym(s)
Accession numberTranspositionOriginHost
AY177680 Y Paracoccus pantotrophus
Paracoccus pantotrophus DSM 11072
DNA section
IS Length : 1376 bp

Ends


IR Length : 26/39

IRL : GAGTAACGCGCGAAAGTTGGTGATGCTCTGAAGGGCGGCATATCAAGGCG
IRR : GAGATATGCGCAGAAGTTGGTGACGCCTGCTCAGGCGGCGGCTTGAAGGT

Insertion site


Left flankDirect repeatRight flankDR Length
GTAAGCACAACCAAAAAAGCCAGTGATTC9

DNA sequence

GAGTAACGCGCGAAAGTTGGTGATGCTCTGAAGGGCGGCATATCAAGGCGGTGTTCAGACGCCGTCAATTCTCAGCCGAGAAAGGGATATGCCACATGTC
AGGCTCTACCATCACCCATCTGCCCGATCCATCGGGATTTTCCTCCGACCCGTTGACCGATCTGGTGCGCGACGGCGCGCGGCAGTTGATCCGTCAGGCT
GTCGAAGCCGAACTGGCGGTCCTGCTTGAACGCCACGCGGCCGACAGGCTGGATGACGGTCGCGCCCGGCTGGTCCGGCATGGACATCTGCCCGAGCGCG
AGGTGCTGACCGGCATCGGCCCGGTGCCGGTGAAGGTGCCTCGCGTTCGGGATCGCGGGGCGGGCGAGGACCGGATCAGTTTCACGCCAAGCATTTTGCC
GCGATACCTGCGCAAGACGAAATCGGTCGCAGAACTGCTGCCATGGCTTTATCTCAAGGGCGTGTCGACCGGGGATTTCAGCGAAGCCCTGGCGGCGCTG
CTCGGTCCGCAGGCGCAGGGTCTGTCGGCGGCGACGATCTCGCGGCTGAAAGCCGACTGGTGGAACGACTATGAAGCCTGGCAAAGGCGTGACCTCGGCA
TGCGCCGCTTCCTCTACATCTGGGCGGACGGGGTTTATTTCAAACCCCGGATGGCCGAAGAGAAACAGTGCGTTCTGGTGATCGTCGGTGCCGATGAATA
TGGCCGCAAGGAGCTGCTGGCCATGACAGACGGCTTCCGCGAAAGCACGCAGAGCTGGCGGGAATTGCTGCTCGATCTCAAACGCCGTGGCCTGAAACAG
GATCCGAAGCTTGCCATCGGTGACGGCGCTCTCGGCTTCTGGGCTGCCTTGCGTGAGGTGTTCGCTACGACACGGGAACAGCGCTGCTGGGTCCACAAGA
CCATGAACGTGCTCAACGCGCTGCCGAAATCGCTGCAGGTCAAGGCCAAGGGGCATCTGCATGACATCTGGCAGGCCGAGACGAAGGTCCAAGCCAATGC
CGCCTTCGATTATTTCATCGAAACCTATGGGGTCAAATACGAAAAGGCGCTCGCCAAGCTGGTCAAGGACCGCGATGCGCTGCTCACCTTCTATGACTTC
CCGGCCGAGCATTGGAAACACATCCGGACGTCAAACCCGATCGAAAGCACCTTCGCCACCGTCCGGCATCGGACCAGACGAACCAAGGGCTGCCTGAGCC
GCAAGACCGGGCTCGCCATGGCATTCCGACTGATGATGTCCGCGCAGAAGAAATGGCGCAAGCTCGACGGTCAGAACCGCCTGCCGGAAATCATCCAGGG
GATTGAATTCCGCGACGGCCTCCGCCACCTTCAAGCCGCCGCCTGAGCAGGCGTCACCAACTTCTGCGCATATCTC
Protein section
ORF number : 1

 

ORF 1
LengthBeginEndStrandFusion ORF
1251 bp416 aa961346+No
ORF function : Transposase
Chemistry : DDE

ORF sequence :

MSGSTITHLPDPSGFSSDPLTDLVRDGARQLIRQAVEAELAVLLERHAADRLDDGRARLVRHGHLPEREVLTGIGPVPVKVPRVRDRGAGEDRISFTPSI
LPRYLRKTKSVAELLPWLYLKGVSTGDFSEALAALLGPQAQGLSAATISRLKADWWNDYEAWQRRDLGMRRFLYIWADGVYFKPRMAEEKQCVLVIVGAD
EYGRKELLAMTDGFRESTQSWRELLLDLKRRGLKQDPKLAIGDGALGFWAALREVFATTREQRCWVHKTMNVLNALPKSLQVKAKGHLHDIWQAETKVQA
NAAFDYFIETYGVKYEKALAKLVKDRDALLTFYDFPAEHWKHIRTSNPIESTFATVRHRTRRTKGCLSRKTGLAMAFRLMMSAQKKWRKLDGQNRLPEII
QGIEFRDGLRHLQAAA

 

Blast result :
Comments
ISPpa1 has been identified by its integration to the entrapment vector pMEC1. IRL of ISPpa1 contains a sequence 5’-AAGTTGGTGAT-3’, which shows similarity (1 mismatch) to the consensus sequence of the integration host factor (IHF) binding site 5’-AANNNNTTGAT-3’.
ISPpa1 is 72% aa similar to IS1490.
References
1]Bartosik,D., Sochacka,M. and Baj,J. (2003) J. Bacteriol. 185 (13), 3753-3763
2]Bartosik,D.(2003) Direct submission.