ISLxx2

  • Family IS110
  • Group
MGE type ISRelated element(s) :
Isoform Synonym(s)
Accession numberTranspositionOriginHost
NC_006087 ND Leifsonia xyli
Leifsonia xyli subsp xyli CTCB07
DNA section
IS Length : 1427 bp

Ends


Left end : GATAGTGAGACTGTTCGTGCTGGTGTTCTCGGGGGTCCTGACCCTCACAGCGATGGACGCGCAAGGATGCTGGTGCCGCGTGTTCTCAGGGGTTCCTGAC
Right end : GCGAGGTCTACTTCCTCCTCAACCCCGGCATCAAACACATCGCCCCGAATACCAAACCGAGGAAAATCGCCGCTTGACTCTTAGGAGAGCATCCGCGGCA

Insertion site


Left flankDirect repeatRight flankDR Length

DNA sequence

GATAGTGAGACTGTTCGTGCTGGTGTTCTCGGGGGTCCTGACCCTCACAGCGATGGACGCGCAAGGATGCTGGTGCCGCGTGTTCTCAGGGGTTCCTGAC
TCTCACGCCGATCGACATCTGCTGTCTTTCCACGGATCTGTCGGTCCCCTGAGAACATCCGGTGAGGCGTCACGCCTCACCGCCGGAGTGACTTAAGGAG
AGCCTGCGCCAACAGGTGCTCATCACTGTCTTGTCCGCCGGTCTGGTGGTGCGCGGTGCCGTTCCCCGCCCATGCGAACAGATCGGAGCACGACATGACC
ATCATCCCCGACACCGGCAAGCAACCTCAATCACGAACGTCGGTGTTCGCCGGCGTCGACACCCATAAGGAGATCCACGTCGCCGCGGTCGTCGACGAGA
CCGGGACAATCCTCGGAACCCACAGCTTCTCCACGACTCGCGCGGGTTATCGGGCCCTGCTGGCATGGGTGCGCAGTCAAGGCGCGTTGGTGCGGATCGG
AATCGAAGGGACGGGCTCCTACGGCGCTGGCCTCGCCCGGCATCTCGCGAAGAACGAGGTGACGATCCTCGAGGTCGACCGGCCGGATCGGTCAGACCGA
CGCCGGAAAGGGAAAGACGATGACCTGGACGCGATCAATGCCGCCCGCGCCGCACTGCACGAGCGCCGTACAACGATCCCGAAGTCCAAGGACGGCGCGG
TCGAGGCCCTGAGAATCCTGCGGGTTGCGCGAGCCCAGGCGGTCCGTGAACGCCGCAACACATTGCAGCTGCTGCGGATGTCGATCGTCGCCGCACCCGA
CGAGGTTCGTGACCAGGTACGCAACCTCACCCGTATGCAGCTGATCCGCCATCTCGCTGCCTGGCGTCCTGACACCTCGAACGCGACCGATCCCGTTGTC
GCCTACCGGGTCGCGTTGAAGTCGTTCGGCCGCCGCTATATCGAGCTCACCGACGAGATCGTCGACCTTGACGACCTGATCAACCCCATCGTCGAGTCCC
TCGCCCCCCAGCTACTCGAACGCGTCGGAATCGGCATCGAAGTCGCCGGGCAGATGCTCGTCACCGCAGGCGACAACCCCGAGAGCATGAAGTCCGAAGC
CGCGTTCGCGATGCTCTGCGGCGTCTCCCCGCTACCCGCGTCCTCCGGAATGACCCAGCGACACCGACTCAACCGTGGTGGCGACCGGCAAGCCAACCGT
GCCCTCCACCTCGCCGTGATCAGCAGGCTCCGGATCGACCCGAGAACGAAGGCCTACGCAGCGAAGAAGACCGCGGAAGGCCACTCGAAGATGGAGATCA
TCCGTTGCCTCAAGCGATACCTCGCCCGCGAGGTCTACTTCCTCCTCAACCCCGGCATCAAACACATCGCCCCGAATACCAAACCGAGGAAAATCGCCGC
TTGACTCTTAGGAGAGCATCCGCGGCA
Protein section
ORF number : 1

 

ORF 1
LengthBeginEndStrandFusion ORF
1110 bp369 aa2951404+No
ORF function : Transposase
Chemistry : DEDD

ORF sequence :

MTIIPDTGKQPQSRTSVFAGVDTHKEIHVAAVVDETGTILGTHSFSTTRAGYRALLAWVRSQGALVRIGIEGTGSYGAGLARHLAKNEVTILEVDRPDRS
DRRRKGKDDDLDAINAARAALHERRTTIPKSKDGAVEALRILRVARAQAVRERRNTLQLLRMSIVAAPDEVRDQVRNLTRMQLIRHLAAWRPDTSNATDP
VVAYRVALKSFGRRYIELTDEIVDLDDLINPIVESLAPQLLERVGIGIEVAGQMLVTAGDNPESMKSEAAFAMLCGVSPLPASSGMTQRHRLNRGGDRQA
NRALHLAVISRLRIDPRTKAYAAKKTAEGHSKMEIIRCLKRYLAREVYFLLNPGIKHIAPNTKPRKIAA

 

Blast result :
Comments
There are 4 copies of ISLxx2 (coordinates : 376418-377844 ; 1351723-1353149 ; 1428339-1429765 ; 2312342-2310916).
ISLxx2 is 44% aa similar to IS1547.
References
1] Monteiro-Vitorello, C.B., Camargo, L.E.A., Van Sluys, M.A., Kitajima, J.P., Truffi, D., do Amaral, A.M., Harakava, R., de Oliveira, J.C., Wood, D., Oliveira, M.C., Miyaki, C., Takita, M.A., da Silva, A.C., Furlan, L.R., Carraro, D.M., Camarotte, G., Almeida Jr, N.F., Carrer, H., Coutinho, L.L., El-Dorry, H.A., Ferro, M.I.T., Gagliardi, P.R., Giglioti, E., Goldman, M.H.S, Goldman, G.H., Kimura, E.T., Ferro, E.S., Kuramae, E.E., Lemos, E.G.M., Lemos, M.V.F., Mauro, S.M.Z., Machado, M.A., Marino, C.L., Menck, C.F.M. , Nunes, L.R., Oliveira, C.L, Pereira, G.G., Siqueira, W., de Souza, A.A., Tsai, S.M., Zanca, A.S., Simpson, A.J.G., Brumbley, S.M., Setúbal, J.C.(2004) Mol. Plant Microbe Interact. 17 (8), 827-836