ISLxx1

  • Family IS21
  • Group
MGE type ISRelated element(s) :
Isoform Synonym(s)
Accession numberTranspositionOriginHost
NC_006087 ND Leifsonia xyli
Leifsonia xyli subsp xyli CTCB07
DNA section
IS Length : 2205 bp

Ends


IR Length : 23

IRL : TGTTAACGCCAAAGTAGAATGGACCCCGTAGCGCCGACTTGGAATGGACC
IRR : TGTTGATGCCGAGTTGGAATGGACCCTTTTGCGCCGATTTGGGGTGGACC

Insertion site


Left flankDirect repeatRight flankDR Length

DNA sequence

TGTTAACGCCAAAGTAGAATGGACCCCGTAGCGCCGACTTGGAATGGACCCCCTGGCTCCAGGCTAGGAGGGTGATTTCAGTGGATACGTGGGCAGAGAT
CCGGCGGTTGCATCGGGCGGAGAAGATCCCGATCAAGCAGATCGCGCGTGATCTTGGTGTCGGGCGGAACACGGTTCGGCGGGCGTTGCGGGGCGAGGAT
CCTCCGGACCGGTCGCGGGGTCCACGGGGCTCGAAATTTGATCCATTCGTGCCGCAGATCAGAGCGCTGCTGGTGGAGTATCCGCGGATGCCGGCGTCGG
TGATCGCGGAGCGGGTGGGATGGTCGTTCTCGTCGTCGTTGTTCCGTGACCGTGTCGCGGAACTGCGGCTGGACTATCTGGGTCTGGACCCGGCGGATCG
GCTCTCTTATGCGGCGGGCGAGGTGATCCAGTGCGATCTCTGGTTCCCCGAGACGCGGGTGGCGGTCGGCGACGGGCAGGACCGGATCTTGCCTGTGCTC
GTGATGTGTCCGGGTTCTCCCGTCGGATCGAGGCGGTCATGCTCCCGTCCAAGCAGGGCGACGACCTGACCTCGGGCATGTGGTCGCTGTTGCAGCGATT
CGGTGGGGTTCCGCGCTCGTTGCTCTGGGACAGGGAAGCCGCGATCGGTGGTCTCGGGAAGCCCACCATCCTCGCGGCGACGTTCGCGGGAACGCTCGCG
ACGAGGATCAAGCTCGCGCCCGCACGAGATCCGGAGACCAAAGGTGTTGTCGAGCGCGCGAACAGATGACTTGGAGACCTCGTTCCTGCCGGGACGGATC
TTTCAGAGCGTCGATGACTTCAACGAGCAGCTGACCGGATGGTTGGATACCCGCGCGAATCAGCGGAAGGTCCGCTCGATCGCGGCCCGCCCGACAGAGC
TCGCGAACGTTGACACGGCGGGGATGCTGGCGCTGCCGGCGAAGCCATCCGCCGTTGGGCTCACCCACCGGGTCCGCCTCGCCCGCGACTATTACGTCCT
CCTCGATGGGAACGACTACTCCGTCCCCGGTTCATTGGCCGGTTCGTCGATATTCGGGCGTCGCTGGACGAGGTCGAGATCACCAGCAACGGGCAACCCG
CCGGCAGGCATCTCCGGTCGTTGCGGACAGGGCAAACGATCACGGCTCCCGAGCATGTCACACAGGCCGCGAAGCTCCGCGCTCACTACCAACGCCCGAA
ACCTTCCGGGGTCAGAGAACATCCAGATGGGCACCGCGTCCAGATTCGGGCGCTGTCGGACTACGACGCCCTGTTCGGCATCGACTTCACGACCACGACC
ACGACCGAATACGAGAAAGAAGCACGATGACCATCAAGAACAGCACGAGCGACGTTCCGATCCCGAAGACCAGCAAGCAGGTCTCCTCGAAGCTTGCCTA
TCTCGCCCGGGCGTTGAAGACGCCAACGATCGGGAGGGTTTGGGAAGACCTCGCCGGCCGAGCCAGAGACGAGAACTGGGCGCATGAGGAATACCTCGCC
GCGGTCCTGGAACGCCAGCTCGCGGACCGGGAATCAGCGGGCACCACGATGCGAATCCGGACCGCGCACTTCCCCGCGATCAAAACCTTGGAGGACTTCA
ACCTCGACCACCTCCCGTCGCTGCGCAAGGATCTTCTCGCACACCTGGCGACATCGACGTTCGTCGTGAAAGCGGAGAACGTGATCCTCCTCGGCCCTCC
CGGGATCGGGAAGACCCACCTCGCGATCGGTCTTGGCGTCAAGGCCACTCACTCCGGGCACAGTGTCTTGTTCGACACCGCGAACAACTGGATCGCCCGC
CTCGCGGCCGCTCACCACCAGGGACAGCTCGAAGCCGAACTGAAGAAGATCCGCCGTTACAAGCTCATCATCATCGACGAGATCGGCTACATCCCCTTCG
ACACCGACTCCGCGAACCTGTTCTTCCAACTCGTCGCGTCCCGTTACGAACAGGGCTCGATCATGGTCACCAGCAACCTGCCGTTCAGCCGCTGGGGCGA
GATCTTCGGAGACGACGTCGTCGCTTCAGCGATGATCGACCGCCTCGTCCACCACTCCGAAGTCCTCACCCTCAACGGAGACTCCTACCGCACCCACGGA
CGCCGCGACCTCATCAAACAGACCGACAAGAACTAAGCTCAACCAACGAAGAAGGGGTCCACCCCAAATCGGCGCAAAAGGGTCCATTCCAACTCGGCAT
CAACA
Protein section
ORF number : 2

 

ORF 1
LengthBeginEndStrandFusion ORF
231 bp76 aa539769+No
ORF function : Transposase
Chemistry : DDE

ORF sequence :

MLPSKQGDDLTSGMWSLLQRFGGVPRSLLWDREAAIGGLGKPTILAATFAGTLATRIKLAPARDPETKGVVERANR

 

Blast result :
ORF 2
LengthBeginEndStrandFusion ORF
1131 bp376 aa10062136+No
ORF function : Accessory Gene
AG : IS21 helper

ORF sequence :

MGTTTPSPVHWPVRRYSGVAGRGRDHQQRATRRQASPVVADRANDHGSRACHTGREAPRSLPTPETFRGQRTSRWAPRPDSGAVGLRRPVRHRLHDHDHD
RIRERSTMTIKNSTSDVPIPKTSKQVSSKLAYLARALKTPTIGRVWEDLAGRARDENWAHEEYLAAVLERQLADRESAGTTMRIRTAHFPAIKTLEDFNL
DHLPSLRKDLLAHLATSTFVVKAENVILLGPPGIGKTHLAIGLGVKATHSGHSVLFDTANNWIARLAAAHHQGQLEAELKKIRRYKLIIIDEIGYIPFDT
DSANLFFQLVASRYEQGSIMVTSNLPFSRWGEIFGDDVVASAMIDRLVHHSEVLTLNGDSYRTHGRRDLIKQTDKN

 

Blast result :
Comments
There are 4 copies of ISLxx1 (coordinates : 2340215-2342419 ; 561383-559179 ; 399220-397016 ; 229479-227275 ).
ISLxx1 is 60%(ORF) aa similar to the first part of the ISMt3 transposase (ORF1)and 76%(ORF2) to ISMt3(ORF2).
References
1] Monteiro-Vitorello, C.B., Camargo, L.E.A., Van Sluys, M.A., Kitajima, J.P., Truffi, D., do Amaral, A.M., Harakava, R., de Oliveira, J.C., Wood, D., Oliveira, M.C., Miyaki, C., Takita, M.A., da Silva, A.C., Furlan, L.R., Carraro, D.M., Camarotte, G., Almeida Jr, N.F., Carrer, H., Coutinho, L.L., El-Dorry, H.A., Ferro, M.I.T., Gagliardi, P.R., Giglioti, E., Goldman, M.H.S, Goldman, G.H., Kimura, E.T., Ferro, E.S., Kuramae, E.E., Lemos, E.G.M., Lemos, M.V.F., Mauro, S.M.Z., Machado, M.A., Marino, C.L., Menck, C.F.M. , Nunes, L.R., Oliveira, C.L, Pereira, G.G., Siqueira, W., de Souza, A.A., Tsai, S.M., Zanca, A.S., Simpson, A.J.G., Brumbley, S.M., Setúbal, J.C.(2004) Mol. Plant Microbe Interact. 17 (8), 827-836