ISLxx3

  • Family IS21
  • Group
MGE type ISRelated element(s) :
Isoform Synonym(s)
Accession numberTranspositionOriginHost
NC_006087 ND Leifsonia xyli
Leifsonia xyli subsp xyli CTCB07
DNA section
IS Length : 2637 bp

Ends


IR Length : 28/31

IRL : ACCACTGGGACGGCTTGATTCGCTACCACCTTTCGACTTGCCGGGTGATC
IRR : ACCGCTAGGACGGCTTGATTCACTACCACCTGGCGGGGCTGGTTAGACGG

Insertion site


Left flankDirect repeatRight flankDR Length

DNA sequence

ACCACTGGGACGGCTTGATTCGCTACCACCTTTCGACTTGCCGGGTGATCGTGACGGTTTGATCGGTGCCCACCCCACCGTTGGAGCATCTGGCGTGATG
TGATGCCAGCGGTGAAGGGCAGACATGAGGTTGCGGATGGAGTTGTTCGCCAGGATCCGGTGTGATGCGTGGGTCGAGGGTCTCTCGATCCGGGAGCTCT
CGCGGCGGCACGGGGTGTCTCGGGAGACGGTGCGGACGGCGTTGTCGCAGGCGGAGCCGTCGCCGAGGAAGGTCCCGGTTCGGGTCGCGTCCCGACTGGA
GTCGTTCAAGGCGGCGATCGATTCGATGCTGCTTGAGGACACGACGTCGCCGAAGAAGCAGCGTCACACGGCCCGACGTGTTCTGGCGCGGTTGGCGGAG
GAGGACGGCGCGGTCGAGTTGTCGTACTCGACGGTCCGGGATTATGTTCGCCGGCGCCGGCCGGAGATCGATGTTGCCGCCGGTCGACGCTTGGAAGTGT
TCGTCCCGCAAGAGCACGCACCTGGCGCTGAGGCGGAAGTCGACTTCGGCGAGGTCTGGGTGATCTTGGCTGGGGTGAAGACGAAGTGCCATATGTTCGC
GTTCCGGCTTTCGCACTCGGGGAAGGCGGTTCACCGCGTCTACTCGACCCAGGGGCAGGAAGCATTCCTCGAGGGCCACATCGACGCGTTCGAAACCATC
GGCGGGATCCCGTCCAAGCACATCAAGTACGACAACCTCACCGCCGCGGTGACCGCGGTGATCTATGGCAAGGGTCGCCGGCGGGCGGAGAATGATCGCT
GGGTGCTCTTTCGTTCCCACTACGGGTTCGACGCGTTCTACTGCCAACCCGGGATCGAGGGAGCACACGAGAAGGGCGGGATCGAGGGCGACGTCGGCCG
GTTCCGACGCAACCATCTCTCACCGATGCCGGTCGTGTCCTCGTTGGCGGAGCTGAATGACCGCATCCGGGTTTGGGACGAGGCGGATGACAACCGGCGG
ATCGCGGACCGGATCCGCACAGTCGGCCAGGACTTCGCCGCTGAGCGGGAACAGCTCGTCTCGTTGCCTTTTGACCGGTTCGATCCCGGCCTGCAGTTGG
CGCCGCGAGTTGACCGGTCGAGCCTGATCACCGTCCGGATGGCGAAATACTCCGTCCCCGCCCGCATGATCGGTCGGCCGGTGCGGGTGTCGTTGCAAGC
GTCGGAGGTGATCGTGTTCGACGGACGCACCGAGATCGCTCGCCACCCCCGAGTCGCGGCCGCGCATGGGCAGAGCGTGAACCTAGACCATTACCTCGAG
GTGCTCCGCGGCAAGCCGGGCGCGCTACCTGGCTCGACCGCACTGGCACAGGCACGCGCCGCGGGGACATTCACCGCTGAGCACGAGGCGTTCTGGGCGG
CAGCGCGCAAGACCGACGGGGATGCCACCGCGACCAGAGAACTGATCGATGTGCTCCTCCTGCATCGATCCATGACGGACGCCGACGTGGTCGCCGGGAT
CGCGGCCGCGCTCACCGTTGGCGCTGTCACCGCGGACGTCGTCGCGGTCGAGGCACGCCGGCACGCCGCTGCGGGTGGTCGCGATTCGAACCGTCATCTC
GTTGAACATCCATCCACCCTTGAGCGGCGGGTTGTCAGCCTCACTCAACGTTGGCTTGCCGACCCGACTGCTGTGATCGCTGGCCTGCCGCCGGACAAAC
GTCCGCTGCCGTCAGTCGCCGGCTATGACGAGCTGTTGACTCGCCGCACACCCCAGTTCCCTGCAGTATCGAATCAGAAGGAAGACACCGGCACATGAGT
CCCATTACCACCACCCTCCGACGTCGTCGCGGGTTGACCGAGGAGGCCGCGACCGCGGCCGTCGATCAAGTCTGCCGGCGGCTGCGCCTGCCCACGATCC
GCGCCGTCGTCGACGAGGCGGTCAAGGTCGCCGAGAAGGAGCAGCTGTCTTACCAGGGGTTCCTCGCGGAGTTGCTGATGGCCGAGTGCGATGACCGCGA
CCGCCGCTCTTCCGTCCGCCGCGTCTCTGCCGCCGGCTTCCCGAGAGACAAATGGTTGGGCGATTTCGACTACGACGCGAACCCGAACATCAACCCCGCC
ACCATCAACCAGCTCGCGACCGGGGAATGGATCCGCAAGAGCCAACCCCTCTGCCTGATCGGGGACTCCGGAACCGGGAAGTCTCACCTGCTGATCGGGC
TCGGCACCGCTGCTGCGGAGAAGGGCTACCGGGTCAAATACACGCTCGCCACGAGGCTCGTGAACGAACTCGTCGAGGCCGCCGACGAGAAGCAGTTGGT
GCGTACGATCGCCCGTTACGGCCGTGTCGACCTGCTCATCATCGACGAGCTCGGCTACATGGAGCTGGACCGCCGCGGTGCCGAGCTCCTCTTCCAAGTC
CTCACCGAGCGTGAGGAGAAGAACTCGATCGCGATCGCCTCCAACGAATCGTTCTCCGGCTGGACCAAGACCTTCACCGACCCCAGACTCTGCGCCGCGA
TCGTTGACCGCCTCACCTTCAACAGCACCATCATCGAGACCGGCACCGACTCCTACCGTCTCGCGCACACCATGAACCAGCTCCAAACCGTCTAACCAGC
CCCGCCAGGTGGTAGTGAATCAAGCCGTCCTAGCGGT
Protein section
ORF number : 2

 

ORF 1
LengthBeginEndStrandFusion ORF
801 bp266 aa43843+No
ORF function : Transposase
Chemistry : DDE

ORF sequence :

MRLRMELFARIRCDAWVEGLSIRELSRRHGVSRETVRTALSQAEPSPRKVPVRVASRLESFKAAIDSMLLEDTTSPKKQRHTARRVLARLAEEDGAVELS
YSTVRDYVRRRRPEIDVAAGRRLEVFVPQEHAPGAEAEVDFGEVWVILAGVKTKCHMFAFRLSHSGKAVHRVYSTQGQEAFLEGHIDAFETIGGIPSKHI
KYDNLTAAVTAVIYGKGRRRAENDRWVLFRSHYGFDAFYCQPGIEGAHEKGGIEGDVGRFRRNHLSPMPVVSSLAELNDRIRVWDEADDNRRIADRIRTV
GQDFAAEREQLVSLPFDRFDPGLQLAPRVDRSSLITVRMAKYSVPARMIGRPVRVSLQASEVIVFDGRTEIARHPRVAAAHGQSVNLDHYLEVLRGKPGA
LPGSTALAQARAAGTFTAEHEAFWAAARKTDGDATATRELIDVLLLHRSMTDADVVAGIAAALTVGAVTADVVAVEARRHAAAGGRDSNRHLVEHPSTLE
RRVVSLTQRWLADPTAVIAGLPPDKRPLPSVAGYDELLTRRTPQFPAVSNQKEDTGT

 

Blast result :
ORF 2
LengthBeginEndStrandFusion ORF
1674 bp557 aa8402513+No
ORF function : Accessory Gene
AG : IS21 helper

ORF sequence :

MSPITTTLRRRRGLTEEAATAAVDQVCRRLRLPTIRAVVDEAVKVAEKEQLSYQGFLAELLMAECDDRDRRSSVRRVSAAGFPRDKWLGDFDYDANPNIN
PATINQLATGEWIRKSQPLCLIGDSGTGKSHLLIGLGTAAAEKGYRVKYTLATRLVNELVEAADEKQLVRTIARYGRVDLLIIDELGYMELDRRGAELLF
QVLTEREEKNSIAIASNESFSGWTKTFTDPRLCAAIVDRLTFNSTIIETGTDSYRLAHTMNQLQTV

 

Blast result :
Comments
There is only one copy of ISLxx3 (coordinates : 1433367-1430731).
ISLxx3 is 46% (ORF1) and 56% (ORF2) aa similar to ISFlsp1.
References
1] Monteiro-Vitorello, C.B., Camargo, L.E.A., Van Sluys, M.A., Kitajima, J.P., Truffi, D., do Amaral, A.M., Harakava, R., de Oliveira, J.C., Wood, D., Oliveira, M.C., Miyaki, C., Takita, M.A., da Silva, A.C., Furlan, L.R., Carraro, D.M., Camarotte, G., Almeida Jr, N.F., Carrer, H., Coutinho, L.L., El-Dorry, H.A., Ferro, M.I.T., Gagliardi, P.R., Giglioti, E., Goldman, M.H.S, Goldman, G.H., Kimura, E.T., Ferro, E.S., Kuramae, E.E., Lemos, E.G.M., Lemos, M.V.F., Mauro, S.M.Z., Machado, M.A., Marino, C.L., Menck, C.F.M. , Nunes, L.R., Oliveira, C.L, Pereira, G.G., Siqueira, W., de Souza, A.A., Tsai, S.M., Zanca, A.S., Simpson, A.J.G., Brumbley, S.M., Setúbal, J.C.(2004) Mol. Plant Microbe Interact. 17 (8), 827-836