ISLxx4

  • Family IS481
  • Group
MGE type ISRelated element(s) :
Isoform Synonym(s)
Accession numberTranspositionOriginHost
NC_006087 ND Leifsonia xyli
Leifsonia xyli subsp xyli CTCB07
DNA section
IS Length : 1110 bp

Ends


IR Length : 21/22

IRL : TGTGATGTCCAGGGGGGTTGTTTCGGCGATACGGTCGTGAGGAGTTGAGG
IRR : TGTGATGTCCAGGGAGGTTGTTGTCGATTCTGCTAATGGGTGGGGCTCTG

Insertion site


Left flankDirect repeatRight flankDR Length
NNNNNNNNNNCCTAGGNNNNNNNNNN6

DNA sequence

TGTGATGTCCAGGGGGGTTGTTTCGGCGATACGGTCGTGAGGAGTTGAGGGGCGAGGGCCTCCGGTTGTGAAGTGGAGCTGTTCAGTTCAACCGCTTCAC
GATCCAGGAGGCCTTCGTGTCCCACGTTAACGCTGCTCTCACACCGCGCGCTCGTCTGCGCCTTGCCAGGCTCATCGTCGAGGACCATTGGCTGGTCTCC
GTCGCAGCGAAGATGTTTATGGTCTCGCCCGTTACCGCGCGGAAATGGGCGGCGAGGTTCCGCGCCGAAGGCACGGGAGGGATGACCGACCGGTCTAGCC
GCCCACGATCGATGCCAACGCGGACGCCGTTGCCCGTGCTCAAGCGGATCGTGCGGGCGAGGTGGCGACGACGCCTGGGGCCGGTGCAGATCGCCGGCGA
GCTTGGCCTTCCCGCCTCGACCGTCCACGCCGTCCTGGTGTGCTGCCGCATCAACCGGCTCTGCACCATTGATCGGGTCACGGGCGAGCCGATCCGTCGC
TACGAGCACGACCACCCTGGATCGCTGATCCATGTCGACGTGACGAAGTTCGGCAACATCCCCGACGGCGGCGGCTGACGATTCGTCGGCCGCGTCCAGG
GCGAACGCAACCGGGAAGCGACCGCCACCCGCACGAAGAGCAGGAACCACCGCTACGAGCCACGGTTGGGCACCGTGTTCGTCTACACGATCATCGACGA
CCACTCCCGCGTCGCCTACGCCGAGATCTGCTCCGACGAGAAGGCGGACACCGCGATCGGTGTCCTGCGGCGTGCTGTCGCCTGGTTCGCCGACCGGGAT
GTCAGCGTCGAACTCGTCCTCTCGGACAACGGCTCCGCCTACAAGTCCTACGCCTGGCGAGACGCCTGCACAGAGCTCGGGATCAGGGCGAAGAAGACCC
GACCATACCGACCACAGACCAACGGGAAGATCGAACGCTTCCACCGCACACTCGCCGACGGCTGGGCCTACGCCCAGTTCTATGGTTCAGAGGCCGAACG
ACGAGAAGCACTCCCCGGCTGGCCCCACTTCTACAATCATCACCAGCACCACTCCGCCATCAGAGCCCCACCCATTAGCAGAATCGACAACAACCTCCCT
GGACATCACA
Protein section
ORF number : 1

 

ORF 1
LengthBeginEndStrandFusion ORF
903 bp331 aa2131115+No
ORF function : Transposase
Chemistry : DDE

ORF sequence :

MSHVNAALTPRARLRLARLIVEDHWLVSVAAKMFMVSPVTARKWAARFRAEGTGGMTDRSSRPRSMPTRTPLPVLKRVRARWRRRLGPVQIAGELGLPAS
TVHAVLVCCRINRLCTIDRVTGEPIRRYEHDHPGSLIHVDVTKFGNIPDGGG*RFVGRVQGERNREATATRTKSRNHRYEPRLGTVFVYTIIDDHSRVAY
AEICSDEKADTAIGVLRRAVAWFADRDVSVELVLSDNGSAYKSYAWRDACTELGIRAKKTRPYRPQTNGKIERFHRTLADGWAYAQFYGSEAERREALPG
WPHFYNHHQHHSAIRAPPISRIDNNLPGHHT

 

Blast result :
Comments
This IS element presents a stop codon in frame at position 576 of the sequence. The true stop codon is dependent upon the duplication of the insertion site [CCTAGG] where a TAG downstream the transposase coding region outside the IS element is created. There are 26 occurrences in the CTCB07 genome.
ISLxx4 is 81% aa similar to IS5564 (ORF2).
References
1] Monteiro-Vitorello, C.B., Camargo, L.E.A., Van Sluys, M.A., Kitajima, J.P., Truffi, D., do Amaral, A.M., Harakava, R., de Oliveira, J.C., Wood, D., Oliveira, M.C., Miyaki, C., Takita, M.A., da Silva, A.C., Furlan, L.R., Carraro, D.M., Camarotte, G., Almeida Jr, N.F., Carrer, H., Coutinho, L.L., El-Dorry, H.A., Ferro, M.I.T., Gagliardi, P.R., Giglioti, E., Goldman, M.H.S, Goldman, G.H., Kimura, E.T., Ferro, E.S., Kuramae, E.E., Lemos, E.G.M., Lemos, M.V.F., Mauro, S.M.Z., Machado, M.A., Marino, C.L., Menck, C.F.M. , Nunes, L.R., Oliveira, C.L, Pereira, G.G., Siqueira, W., de Souza, A.A., Tsai, S.M., Zanca, A.S., Simpson, A.J.G., Brumbley, S.M., Setúbal, J.C.(2004) Mol. Plant Microbe Interact. 17 (8), 827-836