ISLxx5

  • Family IS30
  • Group
MGE type ISRelated element(s) :
Isoform Synonym(s)
Accession numberTranspositionOriginHost
NC_006087 ND Leifsonia xyli
Leifsonia xyli subsp xyli CTCB07
DNA section
IS Length : 1495 bp

Ends


IR Length : 20/23

IRL : GGGTTCTAGCGGTTGTTGCAACATCTGGAGTTTCTAGGAGTTGCAAGGAC
IRR : GGATTCCAGTGGTTGTTGCAACACGACGATTAGCTGGCGAGTAGTTTAGC

Insertion site


Left flankDirect repeatRight flankDR Length

DNA sequence

GGGTTCTAGCGGTTGTTGCAACATCTGGAGTTTCTAGGAGTTGCAAGGACCGTGTCCCGTTTAAGGCGCAGTGCGGGGAAGAGGAAGTACACCCAGGCGG
AGCGTGAAGCCTTCTTCGTCATTTTCAAGGAGTCCAGGAGTACGACGATCGCGGCGAGGGAGCTAGGGTTCAACCCCGCGACGTGCGCGCAATGGGTTCG
CAAGGCGGGCCTGGCTAGTCACGGCTACACCGGCGGCGGCATGAGCGCGCACCCATGCAAGGACGAGTACCTGGAGCTGCGGAGCAGCGGGCTCTCGCGC
CGCGAAGCGGTGGGACGAGTCGGAATCAGCCCGAACACGGGATACCTCTGGGACAGTCGAACGGGCGACGCATTTATCCAGATGGTCGCGTGGTCGATTA
CAAAGACAGGGTGCCTGTCGTTGTTGATCCTGTTCAGCGGGCGTCGATGCGTTCGCTCGAAGCCGCACTCCACCCACGATTCCTCTCCCTGCAGGAGCGT
GAGCTGATCCGGGACCTGACCAGGGCCGGCCTTTCGTTGTGTCGGGTCGCGGCCAAGCTTGGTCGCTCGGTGTCGACGATCAGTCGAGAGATTCGCCGGA
ATCAGCTTCCTGGAGAGGGCGGCTACCATCCATACGTGGCGCATCGGAAAGCGGCCAGCCGCCGACCGCGACCGAAAGCCACGAGGCTGGTCCGCAATCC
GCAGCTGCGCAGTTACGTTCAACGGAAGCTGACGCTACGTTGGTCGCCGGAGCAGATCAGCCGGTCGCTGATCCGCGAGTTCCCCGGCGATGCGGAGATG
CGCGTGGCGCACGAGACGATCTATCAAGCCTTCTACGTGCAGGGCCGTGGACAACTCCGCCGCGAGCTCACGATGGTGCTGCGGACCGGCCGGGCCAAGC
GGAAACCGCATCGTTCTGGCGCCGCTCGCAGACATCGTTTCGCGGATCCGATGGTAATGATCTCCGACCGTCCCGCCGAAATCGAGGACCGCGCCGTTCC
CGGACATTGGGAAGGCGACCTCATCATCGGCGGACACCGCAACAGCGCCATCGGCACCCTCGTGGAACGCTCCACCCGGTTCGTGATGCTGATCCATCTC
CCCATCGATCGCACCGCAGAATCCGTCCGGGACGGACTGATCAGCGCCGTCAAGACACTCCCACGCGAACTCCGTCGCTCGATCACCTGGGACCAGGGCT
CGGAAATGGCAGCTCACAAGTCGTTCACGATAGCCACCGACATCCCGGTCTACTTCTGCGACCCCGCGAGTCCCTGGCAACGCGGCAGCAACGAGAACAC
CAACGGACTCCTTCGCCAATACTTCCCCAAGGGAAAGGGAACAGACCTCGCCCGATTCACCGCAACCGACCTGACGAACGTCGCCCACGAGCTCAACACC
CGCCCACGCAAAACGCTCGGCTGGGAAACCCCAGCCGAACGCCTCGCTAAACTACTCGCCAGCTAATCGTCGTGTTGCAACAACCACTGGAATCC
Protein section
ORF number : 1

 

ORF 1
LengthBeginEndStrandFusion ORF
1212 bp403 aa2551466+No
ORF function : Transposase
Chemistry : DDE

ORF sequence :

MQGRVPGAAEQRALAPRSGGTSRNQPEHGIPLGQSNGRRIYPDGRVVDYKDRVPVVVDPVQRASMRSLEAALHPRFLSLQERELIRDLTRAGLSLCRVAA
KLGRSVSTISREIRRNQLPGEGGYHPYVAHRKAASRRPRPKATRLVRNPQLRSYVQRKLTLRWSPEQISRSLIREFPGDAEMRVAHETIYQAFYVQGRGQ
LRRELTMVLRTGRAKRKPHRSGAARRHRFADPMVMISDRPAEIEDRAVPGHWEGDLIIGGHRNSAIGTLVERSTRFVMLIHLPIDRTAESVRDGLISAVK
TLPRELRRSITWDQGSEMAAHKSFTIATDIPVYFCDPASPWQRGSNENTNGLLRQYFPKGKGTDLARFTATDLTNVAHELNTRPRKTLGWETPAERLAKL
LAS

 

Blast result :
Comments
There are 15 occurrences in the CTCB07 genome.
ISLxx5 is 67% aa similar to ISBlo4.
References
1] Monteiro-Vitorello, C.B., Camargo, L.E.A., Van Sluys, M.A., Kitajima, J.P., Truffi, D., do Amaral, A.M., Harakava, R., de Oliveira, J.C., Wood, D., Oliveira, M.C., Miyaki, C., Takita, M.A., da Silva, A.C., Furlan, L.R., Carraro, D.M., Camarotte, G., Almeida Jr, N.F., Carrer, H., Coutinho, L.L., El-Dorry, H.A., Ferro, M.I.T., Gagliardi, P.R., Giglioti, E., Goldman, M.H.S, Goldman, G.H., Kimura, E.T., Ferro, E.S., Kuramae, E.E., Lemos, E.G.M., Lemos, M.V.F., Mauro, S.M.Z., Machado, M.A., Marino, C.L., Menck, C.F.M. , Nunes, L.R., Oliveira, C.L, Pereira, G.G., Siqueira, W., de Souza, A.A., Tsai, S.M., Zanca, A.S., Simpson, A.J.G., Brumbley, S.M., Setúbal, J.C.(2004) Mol. Plant Microbe Interact. 17 (8), 827-836