ISPlu13

  • Family IS110
  • Group
MGE type ISRelated element(s) :
Isoform Synonym(s)
Accession numberTranspositionOriginHost
NC_005126 ND Photorhabdus luminescens
Photorhabdus luminescens subsp. laumondii TTO1
DNA section
IS Length : 1357 bp

Ends


Left end : CATAAATGCCCCAAGGTAATGAGATGGTTCCCCTCACTCTAACGGCAGTATATTAGCAGAGTGATTATCTTTGATAAGAGGCTACCATCATGAACACTAT
Right end : AGGCGCAGGCTCCTTGCCTACAGTGACGCCGGATAGATTTAAGCAAGCCAAAAATTCATCAAAATGAGTGTTGCAAAAACGAGGGGAACCATAGATTTTT

Insertion site


Left flankDirect repeatRight flankDR Length

DNA sequence

CATAAATGCCCCAAGGTAATGAGATGGTTCCCCTCACTCTAACGGCAGTATATTAGCAGAGTGATTATCTTTGATAAGAGGCTACCATCATGAACACTAT
CGCACTGATTGGCATCGATCTCGGCAAACATTCTTTTCATGTCCATTGTCAGGAGCCATCGGGAAAAGCTCTGCTACGTAAAAAATTCACCCGAACTAAA
TTGATGGAATTCTTAGCCGATTGCTCTCCGGCAACGGTTGTGATGGAAGCCTGTGCTGGCGCGCATTTCATGGCAAGGCGGATCGCTGATTTGGGGCATG
AGGCTAAGCTGATTTCACCGCAGTTTGTCCGTCCTTTTGTCAAAAGTAACAAGAATGATTTTATTGACGCGGAAGCCATCTGTGAAGCCGCCTCACGACC
TTCAATGCGTTTTGTTCAGCCCAGAACGGAAGCCCAACAAGCCATGCGAGCGTTGCATCGTGTCCGGGAATCACTGGTCCGGGATAAAGTCAAAACCACC
AATCAGATGCAAGCTTTCCTGCTTGAGTTTGGCATCAGTATGCCCAAGGGGATTGCCGTGATAAAACGACTCTCCACTGTTTTGGCCGAACATCCTCTTC
CACCTTATTTGGCGCAAATATTACTACGGTTACAGGCGCATTATCACTATCTGGTTGGGCAAATCACCGAGATTGAGACCGCACTGTCACAGGAAATCAT
TCAGGATGATACCGGACAACGGCTGATGACGATCCCCGGTATTGGTCCCATCACGGCGAGTGTGCTTTCCTCACAACTGGGTGATGGAAAACAATATTCT
CGCAGCCGGGATTTTGCGGCCTCGACGGGTTTGGTTCCCCGCCAGTACAGCACCGGGGGAAGGACGACCTTATTGGGTATCAGTAAACGGGGTAATAAGA
CGCTCCGGCAACTGTTGGTACTCTGCGCCCGGTCATTCATGCAACAGATTGAACACCGGCAGGGAAAACTGGCTGACTGGGTTAAGCAGCAGCTTGAACG
AAAGCACTCTAATATCGTGGCCTGTGCATTGGCTAATAAACTCGCCCGGATAGCGTGGGCCATTACGACACAACACACGGTATTTGTCGCCTAAAGCTGG
CGTCATTGTGAACCTATTTAAATGTTACCCCACTGGTTTTGCGAAGACTGATTATTGATGACATGAACGGCCTACCGGCCTGATGAGAAACCTAACATAA
AAAATGGCTCTTTCAAGCCGACAAGGTTTTAAGGTTCATCAGGCGCGGAACTCATCGAGGCGCAGGCTCCTTGCCTACAGTGACGCCGGATAGATTTAAG
CAAGCCAAAAATTCATCAAAATGAGTGTTGCAAAAACGAGGGGAACCATAGATTTTT
Protein section
ORF number : 1

 

ORF 1
LengthBeginEndStrandFusion ORF
1005 bp334 aa901094+No
ORF function : Transposase
Chemistry : DEDD

ORF sequence :

MNTIALIGIDLGKHSFHVHCQEPSGKALLRKKFTRTKLMEFLADCSPATVVMEACAGAHFMARRIADLGHEAKLISPQFVRPFVKSNKNDFIDAEAICEA
ASRPSMRFVQPRTEAQQAMRALHRVRESLVRDKVKTTNQMQAFLLEFGISMPKGIAVIKRLSTVLAEHPLPPYLAQILLRLQAHYHYLVGQITEIETALS
QEIIQDDTGQRLMTIPGIGPITASVLSSQLGDGKQYSRSRDFAASTGLVPRQYSTGGRTTLLGISKRGNKTLRQLLVLCARSFMQQIEHRQGKLADWVKQ
QLERKHSNIVACALANKLARIAWAITTQHTVFVA

 

Blast result :
Comments
ISPlu13 is 84% aa similar to IS4321R.
There are 3 complete and 5 partial copies in the genome.
References
1] Duchaud,E., Rusniok,C., Frangeul,L., Buchrieser,C., Taourit,S., Bocs,S., Boursaux-Eude,C., Chandler,M., Dassa,E., Derose,R.,Derzelle,S., Freyssinet,G., Gaudriault,S., Givaudan,A., Glaser,P.,Medigue,C., Lanois,A., Powell,K., Siguier,P., Wingate,V.,Zouine,M., Boemare,N., Danchin,A. and Kunst,(2003) F.Nat. Biotechnol